P66952 |
UniProt ID : |
P66952 |
NCBI Taxonomy : |
1773 |
Protein names : |
Probable thiol peroxidase |
Organism : |
Mycobacterium tuberculosis |
Taxonomy : |
Bacteria |
Length : |
165 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005618 | Cellular Component | cell wall | IDA | GO:0005829 | Cellular Component | cytosol | TAS | GO:0005576 | Cellular Component | extracellular region | IDA | GO:0015036 | Molecullar Function | disulfide oxidoreductase activity | IDA | GO:0004601 | Molecullar Function | peroxidase activity | IDA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IDA | GO:0052060 | Biological Process | evasion or tolerance by symbiont of host-produced nitric oxide | TAS | GO:0009405 | Biological Process | pathogenesis | IDA | GO:0051409 | Biological Process | response to nitrosative stress | IDA | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
SWISS-MODEL Repository : | P66952 |
Sequences : |
MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA |
Function : | Has antioxidant activity. Could remove peroxides or H(2)O(2) (By similarity). |