P63303
UniProt ID : P63303
NCBI Taxonomy : 9544
Protein names : Selenoprotein W
Organism : Macaca mulatta
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 87
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005739Cellular ComponentmitochondrionNAS
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0003954Molecullar FunctionNADH dehydrogenase activityNAS
GO:0008430Molecullar Functionselenium bindingIEA
GO:0045454Biological Processcell redox homeostasisIEA
SWISS-MODEL Repository :P63303
Sequences : MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG
Function :Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity).