P63301 |
UniProt ID : |
P63301 |
NCBI Taxonomy : |
10116 |
Protein names : |
Selenoprotein W |
Organism : |
Rattus norvegicus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
88 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0008430 | Molecullar Function | selenium binding | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IEA | GO:0010269 | Biological Process | response to selenium ion | IEP | |
SWISS-MODEL Repository : | P63301 |
Sequences : |
MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ |
Function : | Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency. |