P63301
UniProt ID : P63301
NCBI Taxonomy : 10116
Protein names : Selenoprotein W
Organism : Rattus norvegicus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 88
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0008430Molecullar Functionselenium bindingIEA
GO:0045454Biological Processcell redox homeostasisIEA
GO:0010269Biological Processresponse to selenium ionIEP
SWISS-MODEL Repository :P63301
Sequences : MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ
Function :Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency.