P61851 |
UniProt ID : |
P61851 |
NCBI Taxonomy : |
7227 |
Protein names : |
Superoxide dismutase [Cu-Zn] |
Organism : |
Drosophila melanogaster |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
153 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IBA | GO:0005739 | Cellular Component | mitochondrion | IBA | GO:0005634 | Cellular Component | nucleus | IBA | GO:0016209 | Molecullar Function | antioxidant activity | NAS | GO:0005507 | Molecullar Function | copper ion binding | IBA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0008270 | Molecullar Function | zinc ion binding | IBA | GO:0008340 | Biological Process | determination of adult lifespan | IMP | GO:0006979 | Biological Process | response to oxidative stress | IMP | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | P61851 |
Sequences : |
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIGCGVIGIAKV |
Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |