P59760 |
UniProt ID : |
P59760 |
NCBI Taxonomy : |
9913 |
Protein names : |
Glycolactin |
Organism : |
Bos taurus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
49 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005576 | Cellular Component | extracellular region | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0004519 | Molecullar Function | endonuclease activity | IEA | GO:0051607 | Biological Process | defense response to virus | IEA | GO:0017148 | Biological Process | negative regulation of translation | IEA | GO:0090305 | Biological Process | nucleic acid phosphodiester bond hydrolysis | IEA | |
Sequences : |
SALYALYDFSPPARKMRAYTVRAYVHGSYSRRGPWYDFEPVPGASMDGL |
Function : | Manifests poly C-specific RNase activity toward yeast tRNA, elicits a dose-dependent inhibition of cell-free translation, inhibits formation of superoxide ions in vitro and inhibits the hemagglutinating activities of soybean lectin and Ricinus communis agglutinin 120. Inhibits HIV-1 reverse transcriptase. |