P59760
UniProt ID : P59760
NCBI Taxonomy : 9913
Protein names : Glycolactin
Organism : Bos taurus
Taxonomy : Eukaryota
Subcellular locations :Secreted;
Length : 49
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005576Cellular Componentextracellular regionIEA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0004519Molecullar Functionendonuclease activityIEA
GO:0051607Biological Processdefense response to virusIEA
GO:0017148Biological Processnegative regulation of translationIEA
GO:0090305Biological Processnucleic acid phosphodiester bond hydrolysisIEA
Sequences : SALYALYDFSPPARKMRAYTVRAYVHGSYSRRGPWYDFEPVPGASMDGL
Function :Manifests poly C-specific RNase activity toward yeast tRNA, elicits a dose-dependent inhibition of cell-free translation, inhibits formation of superoxide ions in vitro and inhibits the hemagglutinating activities of soybean lectin and Ricinus communis agglutinin 120. Inhibits HIV-1 reverse transcriptase.