P54844
UniProt ID : P54844
NCBI Taxonomy : 10116
Protein names : Transcription factor Maf
Organism : Rattus norvegicus
Taxonomy : Eukaryota
Subcellular locations :Nucleus;
Length : 369
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005634Cellular ComponentnucleusIEA
GO:0003690Molecullar Functiondouble-stranded DNA bindingIDA
GO:0046982Molecullar Functionprotein heterodimerization activityIDA
GO:0042803Molecullar Functionprotein homodimerization activityIDA
GO:0043565Molecullar Functionsequence-specific DNA bindingIEA
GO:0000981Molecullar Functionsequence-specific DNA binding RNA polymerase II transcription factor activityIDA
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoterIDA
SWISS-MODEL Repository :P54844
Sequences : MASELAMNNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPASGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGGAPHYHHHHHHATGHHHHPTAGAPGAAGSASASASGAGGAGGGGPASAGGGGGGGGGGTAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENCSSSDNPSSPEFFM
Function :Acts as a transcriptional activator or repressor. When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T-helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells. It may interact with additional basic-zipper proteins that determine a subtype of Maf-responsive element binding (By similarity).