P52574 |
UniProt ID : |
P52574 |
NCBI Taxonomy : |
38588 |
Protein names : |
Probable 1-Cys peroxiredoxin |
Organism : |
Tortula ruralis |
Taxonomy : |
Eukaryota |
Length : |
218 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
Sequences : |
MGGGWALGDLVPDIQADSTMGHIKVRDYCKDGWTIIFSHPGDYPPVCTTELGKIAAYNPEFEKRGVKLLGLSTDTVEDHQGWIKDIESYTPDAPVLYPILADPDRKITVALNMMDPDEKDANGKPLASRALHIIGPDCRLKLSLLYPGTTGRNFDEVLRVLDSLQLASKHKIATPANWQKGEPVVISPSVSDEKAKQMFPQGWETVNLPKALRMTFVD |
Function : | Associated with the rehydration events involved in the recovery of the desiccation-tolerant moss. |