| P52574 |
| UniProt ID : |
P52574 |
| NCBI Taxonomy : |
38588 |
| Protein names : |
Probable 1-Cys peroxiredoxin |
| Organism : |
Tortula ruralis |
| Taxonomy : |
Eukaryota |
| Length : |
218 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
MGGGWALGDLVPDIQADSTMGHIKVRDYCKDGWTIIFSHPGDYPPVCTTELGKIAAYNPEFEKRGVKLLGLSTDTVEDHQGWIKDIESYTPDAPVLYPILADPDRKITVALNMMDPDEKDANGKPLASRALHIIGPDCRLKLSLLYPGTTGRNFDEVLRVLDSLQLASKHKIATPANWQKGEPVVISPSVSDEKAKQMFPQGWETVNLPKALRMTFVD |
| Function : | Associated with the rehydration events involved in the recovery of the desiccation-tolerant moss. |