A8L1J2
UniProt ID : A8L1J2
NCBI Taxonomy : 298653
Protein names : Alkyl hydroperoxide reductase AhpD
Organism : Frankia sp. (strain EAN1pec)
Taxonomy : Bacteria
Length : 179
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0008785Molecullar Functionalkyl hydroperoxide reductase activityIEA
GO:0032843Molecullar Functionhydroperoxide reductase activityIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0006979Biological Processresponse to oxidative stressIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :A8L1J2
Sequences : MGVARLRELLPDYAKDLRLNLGSVTSQSQLNNQQLWGTVLTSAIASRGATTLTELEAEALEHLSPEAAKAARTAAALMAMNNVYYRTLHLLEDKEYSRMRAGLRMNAIANPGVDKVDFELWSLAASAVNGCGMCLTAHEHELRGRGVSREVIQDAIRVASVVHAVAVTIESHEQVPATA
Function :Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity (By similarity).