P49924 |
UniProt ID : |
P49924 |
NCBI Taxonomy : |
9823 |
Protein names : |
Fatty acid-binding protein, liver |
Organism : |
Sus scrofa |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
127 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0005634 | Cellular Component | nucleus | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0003682 | Molecullar Function | chromatin binding | IEA | GO:0008289 | Molecullar Function | lipid binding | IEA | GO:0005215 | Molecullar Function | transporter activity | IEA | GO:0070301 | Biological Process | cellular response to hydrogen peroxide | IEA | GO:0071456 | Biological Process | cellular response to hypoxia | IEA | GO:0043066 | Biological Process | negative regulation of apoptotic process | IEA | GO:0043154 | Biological Process | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | IEA | |
SWISS-MODEL Repository : | P49924 |
Sequences : |
MNFSGKYQVQSQENFEAFMKAVGLPDELIQKGKDIKGTSEIVQNGKHFKLTITTGSKVVQNEFTLGEECEMETLTGEKVKTVVQLEGDNKLVTTFKGIKSVTELNGDIITSTMTLGDIVFKRISKRI |
Function : | Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. |