P49924
UniProt ID : P49924
NCBI Taxonomy : 9823
Protein names : Fatty acid-binding protein, liver
Organism : Sus scrofa
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 127
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0005634Cellular ComponentnucleusIEA
GO:0016209Molecullar Functionantioxidant activityIEA
GO:0003682Molecullar Functionchromatin bindingIEA
GO:0008289Molecullar Functionlipid bindingIEA
GO:0005215Molecullar Functiontransporter activityIEA
GO:0070301Biological Processcellular response to hydrogen peroxideIEA
GO:0071456Biological Processcellular response to hypoxiaIEA
GO:0043066Biological Processnegative regulation of apoptotic processIEA
GO:0043154Biological Processnegative regulation of cysteine-type endopeptidase activity involved in apoptotic processIEA
SWISS-MODEL Repository :P49924
Sequences : MNFSGKYQVQSQENFEAFMKAVGLPDELIQKGKDIKGTSEIVQNGKHFKLTITTGSKVVQNEFTLGEECEMETLTGEKVKTVVQLEGDNKLVTTFKGIKSVTELNGDIITSTMTLGDIVFKRISKRI
Function :Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.