P49908 |
UniProt ID : |
P49908 |
NCBI Taxonomy : |
9606 |
Protein names : |
Selenoprotein P |
Organism : |
Homo sapiens |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
381 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005576 | Cellular Component | extracellular region | NAS | GO:0005615 | Cellular Component | extracellular space | IEA | GO:0008430 | Molecullar Function | selenium binding | TAS | GO:0007420 | Biological Process | brain development | IEA | GO:0040007 | Biological Process | growth | IEA | GO:0007626 | Biological Process | locomotory behavior | IEA | GO:0009791 | Biological Process | post-embryonic development | IEA | GO:0006979 | Biological Process | response to oxidative stress | TAS | GO:0001887 | Biological Process | selenium compound metabolic process | IEA | GO:0019953 | Biological Process | sexual reproduction | IEA | |
Sequences : |
MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIPTEASASURUKNQAKKUEUPSN |
Function : | Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. |