P49908
UniProt ID : P49908
NCBI Taxonomy : 9606
Protein names : Selenoprotein P
Organism : Homo sapiens
Taxonomy : Eukaryota
Subcellular locations :Secreted;
Length : 381
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005576Cellular Componentextracellular regionNAS
GO:0005615Cellular Componentextracellular spaceIEA
GO:0008430Molecullar Functionselenium bindingTAS
GO:0007420Biological Processbrain developmentIEA
GO:0040007Biological ProcessgrowthIEA
GO:0007626Biological Processlocomotory behaviorIEA
GO:0009791Biological Processpost-embryonic developmentIEA
GO:0006979Biological Processresponse to oxidative stressTAS
GO:0001887Biological Processselenium compound metabolic processIEA
GO:0019953Biological Processsexual reproductionIEA
Sequences : MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASUYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSUCCHCRHLIFEKTGSAITUQCKENLPSLCSUQGLRAEENITESCQURLPPAAUQISQQLIPTEASASURUKNQAKKUEUPSN
Function :Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.