P49114 |
UniProt ID : |
P49114 |
NCBI Taxonomy : |
10141 |
Protein names : |
Superoxide dismutase [Mn], mitochondrial |
Organism : |
Cavia porcellus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Mitochondrion matrix; |
Length : |
211 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005759 | Cellular Component | mitochondrial matrix | IEA | GO:0030145 | Molecullar Function | manganese ion binding | ISS | GO:0004784 | Molecullar Function | superoxide dismutase activity | ISS | GO:0001315 | Biological Process | age-dependent response to reactive oxygen species | ISS | GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ISS | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | P49114 |
Sequences : |
MLCRAVCSASRRLAPALGILGVRQKHSLPDLPYDYGALQPHINAEIMQLHHSKHHAAYLNNLNIAEEKYQEALAKGDVTAQVALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAVSVGVQGSGWGWLGFNKERGCLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQLKNVRPDYLKAIWKVIKNS |
Function : | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |