P49114
UniProt ID : P49114
NCBI Taxonomy : 10141
Protein names : Superoxide dismutase [Mn], mitochondrial
Organism : Cavia porcellus
Taxonomy : Eukaryota
Subcellular locations :Mitochondrion matrix;
Length : 211
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005759Cellular Componentmitochondrial matrixIEA
GO:0030145Molecullar Functionmanganese ion bindingISS
GO:0004784Molecullar Functionsuperoxide dismutase activityISS
GO:0001315Biological Processage-dependent response to reactive oxygen speciesISS
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoterISS
GO:0006801Biological Processsuperoxide metabolic processIEA
Catalytic activity :2 superoxide + 2 H+ = O2 + H2O2.
SWISS-MODEL Repository :P49114
Sequences : MLCRAVCSASRRLAPALGILGVRQKHSLPDLPYDYGALQPHINAEIMQLHHSKHHAAYLNNLNIAEEKYQEALAKGDVTAQVALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAVSVGVQGSGWGWLGFNKERGCLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQLKNVRPDYLKAIWKVIKNS
Function :Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.