P46418 |
UniProt ID : |
P46418 |
NCBI Taxonomy : |
10116 |
Protein names : |
Glutathione S-transferase alpha-5 |
Organism : |
Rattus norvegicus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
221 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005640 | Cellular Component | nuclear outer membrane | IDA | GO:0008144 | Molecullar Function | drug binding | IDA | GO:0043295 | Molecullar Function | glutathione binding | IDA | GO:0004364 | Molecullar Function | glutathione transferase activity | IDA | GO:0007568 | Biological Process | aging | IEP | GO:0042493 | Biological Process | response to drug | NAS | GO:0031667 | Biological Process | response to nutrient levels | IEP | GO:0042178 | Biological Process | xenobiotic catabolic process | IDA | |
Catalytic activity : | RX + glutathione = HX + R-S-glutathione. |
SWISS-MODEL Repository : | P46418 |
Sequences : |
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS |
Function : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has substantial activity toward aflatoxin B1-8,9-epoxide. |