| P46418 |
| UniProt ID : |
P46418 |
| NCBI Taxonomy : |
10116 |
| Protein names : |
Glutathione S-transferase alpha-5 |
| Organism : |
Rattus norvegicus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
221 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005640 | Cellular Component | nuclear outer membrane | IDA | | GO:0008144 | Molecullar Function | drug binding | IDA | | GO:0043295 | Molecullar Function | glutathione binding | IDA | | GO:0004364 | Molecullar Function | glutathione transferase activity | IDA | | GO:0007568 | Biological Process | aging | IEP | | GO:0042493 | Biological Process | response to drug | NAS | | GO:0031667 | Biological Process | response to nutrient levels | IEP | | GO:0042178 | Biological Process | xenobiotic catabolic process | IDA | |
| Catalytic activity : | RX + glutathione = HX + R-S-glutathione. |
| SWISS-MODEL Repository : | P46418 |
| Sequences : |
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS |
| Function : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has substantial activity toward aflatoxin B1-8,9-epoxide. |