P46418
UniProt ID : P46418
NCBI Taxonomy : 10116
Protein names : Glutathione S-transferase alpha-5
Organism : Rattus norvegicus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 221
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0005640Cellular Componentnuclear outer membraneIDA
GO:0008144Molecullar Functiondrug bindingIDA
GO:0043295Molecullar Functionglutathione bindingIDA
GO:0004364Molecullar Functionglutathione transferase activityIDA
GO:0007568Biological ProcessagingIEP
GO:0042493Biological Processresponse to drugNAS
GO:0031667Biological Processresponse to nutrient levelsIEP
GO:0042178Biological Processxenobiotic catabolic processIDA
Catalytic activity :RX + glutathione = HX + R-S-glutathione.
SWISS-MODEL Repository :P46418
Sequences : MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS
Function :Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has substantial activity toward aflatoxin B1-8,9-epoxide.