P41975
UniProt ID : P41975
NCBI Taxonomy : 9986
Protein names : Extracellular superoxide dismutase [Cu-Zn]
Organism : Oryctolagus cuniculus
Taxonomy : Eukaryota
Subcellular locations :Secreted;
Length : 244
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0031012Cellular Componentextracellular matrixIEA
GO:0005615Cellular Componentextracellular spaceIEA
GO:0005802Cellular Componenttrans-Golgi networkIEA
GO:0005507Molecullar Functioncopper ion bindingIEA
GO:0004784Molecullar Functionsuperoxide dismutase activityIEA
GO:0008270Molecullar Functionzinc ion bindingIEA
GO:0001666Biological Processresponse to hypoxiaIEA
GO:0006801Biological Processsuperoxide metabolic processIEA
Catalytic activity :2 superoxide + 2 H+ = O2 + H2O2.
Sequences : MLALVCSCLLLAALPADTWSGPAAVELGSDTVEQIRDTHAKVTEIWQALTQQRAAQGEPAGALHAVCRVQPSATLDAAQPRVSGLVVFRQLGPGAQLEAFFDLEGFPVEANLSSRAIHVHQFGDLSQGCDSTGAHYNPLAVQHPQHPGDFGNFAVRDGRLWKYRSGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNAASVENGNAGPRLACCVVGASGPAPWARQAQEHAERKKRRRESECKAA
Function :Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen (By similarity).