P41975 |
UniProt ID : |
P41975 |
NCBI Taxonomy : |
9986 |
Protein names : |
Extracellular superoxide dismutase [Cu-Zn] |
Organism : |
Oryctolagus cuniculus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
244 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0031012 | Cellular Component | extracellular matrix | IEA | GO:0005615 | Cellular Component | extracellular space | IEA | GO:0005802 | Cellular Component | trans-Golgi network | IEA | GO:0005507 | Molecullar Function | copper ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0008270 | Molecullar Function | zinc ion binding | IEA | GO:0001666 | Biological Process | response to hypoxia | IEA | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
Sequences : |
MLALVCSCLLLAALPADTWSGPAAVELGSDTVEQIRDTHAKVTEIWQALTQQRAAQGEPAGALHAVCRVQPSATLDAAQPRVSGLVVFRQLGPGAQLEAFFDLEGFPVEANLSSRAIHVHQFGDLSQGCDSTGAHYNPLAVQHPQHPGDFGNFAVRDGRLWKYRSGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNAASVENGNAGPRLACCVVGASGPAPWARQAQEHAERKKRRRESECKAA |
Function : | Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen (By similarity). |