| P41974 |
| UniProt ID : |
P41974 |
| NCBI Taxonomy : |
6287 |
| Protein names : |
Extracellular superoxide dismutase [Cu-Zn] |
| Organism : |
Dirofilaria immitis |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
195 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005615 | Cellular Component | extracellular space | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
|
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | P41974 |
| Sequences : |
MMGSFIFLLSIIISINYINSLHTVHRSNIHRNMHNGGMPKKAVAVLKSDTVNGIIYFQQNNRASATTIYGTINGLTPGLHGFHIHQYGIKANGCTSAAAHYNPFEKTHGRPTNNIKHIGDLRNIKAGADGVANVNIISNHIQLSGPLSVIGRSLVVHANPDDLGKGNGDAREESLKTGNAGSRIVCSIIGIAPST |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. May act in the parasite defense by neutralizing superoxide generated by activated leukocytes, thus acting as both an antioxidant and an anti-inflammatory factor. |