P41963 |
UniProt ID : |
P41963 |
NCBI Taxonomy : |
6280 |
Protein names : |
Extracellular superoxide dismutase [Cu-Zn] |
Organism : |
Brugia pahangi |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
199 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005615 | Cellular Component | extracellular space | IEA | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | P41963 |
Sequences : |
MMIASFAIFLSHIIFITYATSNQRYFKPNMHNNMTITIRRTITKTATAIAVLHSDNGNINGTIHFQQDKNSTTISGEIKGLTPGLHGFHVHQYGDTTNGCISAGPHFNPYNKTHGDPTDEMRHVGDLGNIVAGADGTAHIDISDKHVQLLGPNSIIGRSLVVHADQDDLGKGVGDKKDESLKTGNAGGRVACGIVAISA |
Function : | Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen. May act in the parasite defense by neutralizing superoxide generated by activated leukocytes, thus acting as both an antioxidant and an anti-inflammatory factor. |