P41963
UniProt ID : P41963
NCBI Taxonomy : 6280
Protein names : Extracellular superoxide dismutase [Cu-Zn]
Organism : Brugia pahangi
Taxonomy : Eukaryota
Subcellular locations :Secreted;
Length : 199
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005615Cellular Componentextracellular spaceIEA
GO:0046872Molecullar Functionmetal ion bindingIEA
GO:0004784Molecullar Functionsuperoxide dismutase activityIEA
GO:0006801Biological Processsuperoxide metabolic processIEA
Catalytic activity :2 superoxide + 2 H+ = O2 + H2O2.
SWISS-MODEL Repository :P41963
Sequences : MMIASFAIFLSHIIFITYATSNQRYFKPNMHNNMTITIRRTITKTATAIAVLHSDNGNINGTIHFQQDKNSTTISGEIKGLTPGLHGFHVHQYGDTTNGCISAGPHFNPYNKTHGDPTDEMRHVGDLGNIVAGADGTAHIDISDKHVQLLGPNSIIGRSLVVHADQDDLGKGVGDKKDESLKTGNAGGRVACGIVAISA
Function :Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen. May act in the parasite defense by neutralizing superoxide generated by activated leukocytes, thus acting as both an antioxidant and an anti-inflammatory factor.