P40581
UniProt ID : P40581
NCBI Taxonomy : 559292
Protein names : Peroxiredoxin HYR1
Organism : Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Mitochondrion intermembrane space;Peroxisome matrix;
Length : 163
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005758Cellular Componentmitochondrial intermembrane spaceIDA
GO:0005782Cellular Componentperoxisomal matrixIDA
GO:0004602Molecullar Functionglutathione peroxidase activityIMP
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0047066Molecullar Functionphospholipid-hydroperoxide glutathione peroxidase activityIDA
GO:0034599Biological Processcellular response to oxidative stressIMP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :P40581
Sequences : MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEVE
Function :Involved in oxidative stress response and redox homeostasis. Functions as a sensor and transducer of hydroperoxide stress. In response to hydroperoxide stress it oxidizes (activates) the transcription activator YAP1, which is involved in transcription activation of genes of the oxidative stress response pathway. May also play a direct role in hydroperoxide scavenging, being the most active of three closely related S.cerevisiae peroxiredoxins (GPX1, GPX2, and HYP1/GPX3) with respect to peroxide and lipid hydroperoxide reduction. The three enzymes are not required for the glutaredoxin-mediated antioxidant function. In the presence of peroxides, HYP1 is directly oxidized at Cys-36 to form a cysteine sulfenic acid (-SOH). Cys-36-SOH then forms either an intramolecular disulfide bond (Cys-36 with Cys-82) or a transient, intermolecular disulfide bond with 'Cys-598' of YAP1, which is further resolved into a YAP1 intramolecular disulfide bond ('Cys-303' with 'Cys-598') and a reduced Cys-36 in HYP1/GPX3.