P40581 |
UniProt ID : |
P40581 |
NCBI Taxonomy : |
559292 |
Protein names : |
Peroxiredoxin HYR1 |
Organism : |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm;Mitochondrion intermembrane space;Peroxisome matrix; |
Length : |
163 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005758 | Cellular Component | mitochondrial intermembrane space | IDA | GO:0005782 | Cellular Component | peroxisomal matrix | IDA | GO:0004602 | Molecullar Function | glutathione peroxidase activity | IMP | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0047066 | Molecullar Function | phospholipid-hydroperoxide glutathione peroxidase activity | IDA | GO:0034599 | Biological Process | cellular response to oxidative stress | IMP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P40581 |
Sequences : |
MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTIIGFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEVE |
Function : | Involved in oxidative stress response and redox homeostasis. Functions as a sensor and transducer of hydroperoxide stress. In response to hydroperoxide stress it oxidizes (activates) the transcription activator YAP1, which is involved in transcription activation of genes of the oxidative stress response pathway. May also play a direct role in hydroperoxide scavenging, being the most active of three closely related S.cerevisiae peroxiredoxins (GPX1, GPX2, and HYP1/GPX3) with respect to peroxide and lipid hydroperoxide reduction. The three enzymes are not required for the glutaredoxin-mediated antioxidant function. In the presence of peroxides, HYP1 is directly oxidized at Cys-36 to form a cysteine sulfenic acid (-SOH). Cys-36-SOH then forms either an intramolecular disulfide bond (Cys-36 with Cys-82) or a transient, intermolecular disulfide bond with 'Cys-598' of YAP1, which is further resolved into a YAP1 intramolecular disulfide bond ('Cys-303' with 'Cys-598') and a reduced Cys-36 in HYP1/GPX3. |