show

P40554

UniProt ID :

P40554

NCBI Taxonomy :

559292

Protein names :

Ubiquitin-related modifier 1

Organism :

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Nucleus;

Length :

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IDA
GO:0005634	Cellular Component	nucleus	IEA
GO:0031386	Molecullar Function	protein tag	IDA
GO:0007114	Biological Process	cell budding	IGI
GO:0034599	Biological Process	cellular response to oxidative stress	IDA
GO:0001403	Biological Process	invasive growth in response to glucose limitation	IMP
GO:0032447	Biological Process	protein urmylation	IDA
GO:0002143	Biological Process	tRNA wobble position uridine thiolation	IMP

SWISS-MODEL Repository :

P40554

Sequences :

MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG

Function :

Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by UBA4. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. Also acts as an ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as AHP1. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates. Indirectly involved in regulation of budding and haploid invasive growth.