P40553 |
UniProt ID : |
P40553 |
NCBI Taxonomy : |
559292 |
Protein names : |
Peroxiredoxin DOT5 |
Organism : |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
Taxonomy : |
Eukaryota |
Subcellular locations : | Nucleus;Chromosome; |
Length : |
215 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0000781 | Cellular Component | chromosome, telomeric region | IEA | GO:0005634 | Cellular Component | nucleus | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | GO:0045454 | Biological Process | cell redox homeostasis | IDA | GO:0034599 | Biological Process | cellular response to oxidative stress | IGI | GO:0006355 | Biological Process | regulation of transcription, DNA-dependent | IEA | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P40553 |
Sequences : |
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE |
Function : | Has a role in telomere silencing, which is the repression of chromatin structure which leads to a stop in the transcription of nearby genes. Also has a role in the regulation of telomere length. Acts as an alkyl-hydroperoxide reductase in the nucleus during post-diauxic growth. Preferentially reduces alkyl-hydroperoxides rather than hydrogen preoxide. Acts as an antioxidant necessary for stationary phase survival. |