P40553
UniProt ID : P40553
NCBI Taxonomy : 559292
Protein names : Peroxiredoxin DOT5
Organism : Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomy : Eukaryota
Subcellular locations :Nucleus;Chromosome;
Length : 215
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0000781Cellular Componentchromosome, telomeric regionIEA
GO:0005634Cellular ComponentnucleusIDA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIDA
GO:0045454Biological Processcell redox homeostasisIDA
GO:0034599Biological Processcellular response to oxidative stressIGI
GO:0006355Biological Processregulation of transcription, DNA-dependentIEA
GO:0006351Biological Processtranscription, DNA-dependentIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :P40553
Sequences : MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
Function :Has a role in telomere silencing, which is the repression of chromatin structure which leads to a stop in the transcription of nearby genes. Also has a role in the regulation of telomere length. Acts as an alkyl-hydroperoxide reductase in the nucleus during post-diauxic growth. Preferentially reduces alkyl-hydroperoxides rather than hydrogen preoxide. Acts as an antioxidant necessary for stationary phase survival.