| P38918 |
| UniProt ID : |
P38918 |
| NCBI Taxonomy : |
10116 |
| Protein names : |
Aflatoxin B1 aldehyde reductase member 3 |
| Organism : |
Rattus norvegicus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
327 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0004032 | Molecullar Function | alditol:NADP+ 1-oxidoreductase activity | IDA | | GO:0046223 | Biological Process | aflatoxin catabolic process | IMP | | GO:0009636 | Biological Process | response to toxic substance | IEA | |
|
| SWISS-MODEL Repository : | P38918 |
| Sequences : |
MSQARPATVLGAMEMGRRMDVTSSSASVRAFLQRGHTEIDTAFVYANGQSETILGDLGLGLGRSGCKVKIATKAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHGTPIEETLQACHQLHQEGKFVELGLSNYVSWEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGRYKYQDKDGKNPESRFFGNPFSQLYMDRYWKEEHFNGIALVEKALKTTYGPTAPSMISAAVRWMYHHSQLKGTQGDAVILGMSSLEQLEQNLALVEEGPLEPAVVDAFDQAWNLVAHECPNYFR |
| Function : | Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. Probably involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen. |