| P38013 |
| UniProt ID : |
P38013 |
| NCBI Taxonomy : |
559292 |
| Protein names : |
Peroxiredoxin type-2 |
| Organism : |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
176 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IDA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | | GO:0045454 | Biological Process | cell redox homeostasis | IDA | | GO:0034599 | Biological Process | cellular response to oxidative stress | IGI | | GO:0010038 | Biological Process | response to metal ion | IMP | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | P38013 |
| Sequences : |
MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL |
| Function : | Thiol-specific antioxidant protein with alkyl hydroperoxidase activity. Involved in osmotic stress resistance and detoxification of the cell. Preferentially eliminates organic peroxides rather than H(2)O(2). Involved in cellular Mn(2+) homeostasis. |