P35704 |
UniProt ID : |
P35704 |
NCBI Taxonomy : |
10116 |
Protein names : |
Peroxiredoxin-2 |
Organism : |
Rattus norvegicus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
198 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0043524 | Biological Process | negative regulation of neuron apoptotic process | IMP | GO:0019430 | Biological Process | removal of superoxide radicals | IEA | GO:0006979 | Biological Process | response to oxidative stress | IMP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P35704 |
Sequences : |
MASGNAHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Function : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |