P35704
UniProt ID : P35704
NCBI Taxonomy : 10116
Protein names : Peroxiredoxin-2
Organism : Rattus norvegicus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 198
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0043524Biological Processnegative regulation of neuron apoptotic processIMP
GO:0019430Biological Processremoval of superoxide radicalsIEA
GO:0006979Biological Processresponse to oxidative stressIMP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :P35704
Sequences : MASGNAHIGKPAPDFTGTAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).