show

P35700

UniProt ID :

P35700

NCBI Taxonomy :

10090

Protein names :

Peroxiredoxin-1

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Melanosome;

Length :

199

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IEA
GO:0042470	Cellular Component	melanosome	IEA
GO:0005759	Cellular Component	mitochondrial matrix	IEA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0005719	Cellular Component	nuclear euchromatin	IEA
GO:0005730	Cellular Component	nucleolus	IEA
GO:0005782	Cellular Component	peroxisomal matrix	IEA
GO:0020037	Molecullar Function	heme binding	IEA
GO:0008379	Molecullar Function	thioredoxin peroxidase activity	IEA
GO:0008283	Biological Process	cell proliferation	IMP
GO:0034101	Biological Process	erythrocyte homeostasis	IMP
GO:0042744	Biological Process	hydrogen peroxide catabolic process	IEA
GO:0042267	Biological Process	natural killer cell mediated cytotoxicity	IMP
GO:0042345	Biological Process	regulation of NF-kappaB import into nucleus	IMP
GO:0032872	Biological Process	regulation of stress-activated MAPK cascade	IMP
GO:0019430	Biological Process	removal of superoxide radicals	IMP

Catalytic activity :

2 R'-SH + ROOH = R'-S-S-R' + H₂O + ROH.

SWISS-MODEL Repository :

P35700

Sequences :

MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

Function :

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Regulates GDPD5 function by reducing an intramolecular disulfide bond (By similarity). Cooperates with GDPD5 to drive postmitotic motor neuron differentiation.