P34760
UniProt ID : P34760
NCBI Taxonomy : 559292
Protein names : Peroxiredoxin TSA1
Organism : Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 196
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0005844Cellular ComponentpolysomeIDA
GO:0043022Molecullar Functionribosome bindingIDA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIDA
GO:0051082Molecullar Functionunfolded protein bindingIMP
GO:0045454Biological Processcell redox homeostasisIDA
GO:0034599Biological Processcellular response to oxidative stressIDA
GO:0000077Biological ProcessDNA damage checkpointIGI
GO:0042262Biological ProcessDNA protectionIMP
GO:0006457Biological Processprotein foldingIMP
GO:0001302Biological Processreplicative cell agingIMP
GO:0033194Biological Processresponse to hydroperoxideIMP
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :P34760
Sequences : MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK
Function :Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol.