P34760 |
UniProt ID : |
P34760 |
NCBI Taxonomy : |
559292 |
Protein names : |
Peroxiredoxin TSA1 |
Organism : |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
196 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0005844 | Cellular Component | polysome | IDA | GO:0043022 | Molecullar Function | ribosome binding | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | GO:0051082 | Molecullar Function | unfolded protein binding | IMP | GO:0045454 | Biological Process | cell redox homeostasis | IDA | GO:0034599 | Biological Process | cellular response to oxidative stress | IDA | GO:0000077 | Biological Process | DNA damage checkpoint | IGI | GO:0042262 | Biological Process | DNA protection | IMP | GO:0006457 | Biological Process | protein folding | IMP | GO:0001302 | Biological Process | replicative cell aging | IMP | GO:0033194 | Biological Process | response to hydroperoxide | IMP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P34760 |
Sequences : |
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK |
Function : | Physiologically important antioxidant which constitutes an enzymatic defense against sulfur-containing radicals. Can provide protection against a thiol-containing oxidation system but not against an oxidation system without thiol. |