| P34697 |
| UniProt ID : |
P34697 |
| NCBI Taxonomy : |
6239 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Caenorhabditis elegans |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
180 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005634 | Cellular Component | nucleus | IBA | | GO:0005507 | Molecullar Function | copper ion binding | IDA | | GO:0042803 | Molecullar Function | protein homodimerization activity | IDA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IDA | | GO:0008270 | Molecullar Function | zinc ion binding | IBA | | GO:0001306 | Biological Process | age-dependent response to oxidative stress | IDA | | GO:0060378 | Biological Process | regulation of brood size | IMP | | GO:0040028 | Biological Process | regulation of vulval development | IGI | | GO:0019430 | Biological Process | removal of superoxide radicals | IMP | |
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | P34697 |
| Sequences : |
MFMNLLTQVSNAIFPQVEAAQKMSNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAPQ |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Required for normal brood size. |