P34227 |
UniProt ID : |
P34227 |
NCBI Taxonomy : |
559292 |
Protein names : |
Mitochondrial peroxiredoxin PRX1 |
Organism : |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
Taxonomy : |
Eukaryota |
Subcellular locations : | Mitochondrion; |
Length : |
261 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005739 | Cellular Component | mitochondrion | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | GO:0045454 | Biological Process | cell redox homeostasis | IDA | GO:0034599 | Biological Process | cellular response to oxidative stress | IGI | GO:0046686 | Biological Process | response to cadmium ion | IMP | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P34227 |
Sequences : |
MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDADTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDEAKAKFGQFNEIKPYLRFTKSK |
Function : | Has a thioredoxin peroxidase activity with a role in reduction of hydroperoxides. |