P32119
UniProt ID : P32119
NCBI Taxonomy : 9606
Protein names : Peroxiredoxin-2
Organism : Homo sapiens
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 198
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmTAS
GO:0005829Cellular ComponentcytosolIEA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIDA
GO:0042744Biological Processhydrogen peroxide catabolic processTAS
GO:0043066Biological Processnegative regulation of apoptotic processTAS
GO:0043524Biological Processnegative regulation of neuron apoptotic processIEA
GO:0019430Biological Processremoval of superoxide radicalsIDA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :P32119
Sequences : MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).