P32119 |
UniProt ID : |
P32119 |
NCBI Taxonomy : |
9606 |
Protein names : |
Peroxiredoxin-2 |
Organism : |
Homo sapiens |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
198 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | TAS | GO:0005829 | Cellular Component | cytosol | IEA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | TAS | GO:0043066 | Biological Process | negative regulation of apoptotic process | TAS | GO:0043524 | Biological Process | negative regulation of neuron apoptotic process | IEA | GO:0019430 | Biological Process | removal of superoxide radicals | IDA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P32119 |
Sequences : |
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
Function : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |