| P28758 |
| UniProt ID : |
P28758 |
| NCBI Taxonomy : |
284812 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
154 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IDA | | GO:0005758 | Cellular Component | mitochondrial intermembrane space | ISO | | GO:0005634 | Cellular Component | nucleus | IDA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IMP | | GO:0001320 | Biological Process | age-dependent response to reactive oxygen species involved in chronological cell aging | ISO | | GO:0045454 | Biological Process | cell redox homeostasis | IMP | | GO:0006878 | Biological Process | cellular copper ion homeostasis | ISS | | GO:0006882 | Biological Process | cellular zinc ion homeostasis | IMP | | GO:0019430 | Biological Process | removal of superoxide radicals | IMP | |
|
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | P28758 |
| Sequences : |
MVRAVAVLRGDSKVSGVVTFEQVDQNSQVSVIVDLVGNDANAKRGFHIHQFGDNTNGCTSAGPHFNPEGKTHGDRTAAVRHVGDLGNLESDAQGNIKTTFSDSVISLFGANSIIGRTIVIHAGEDDLGKGTSEESLKTGNAGARNACGVIGIAV |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |