P27170 |
UniProt ID : |
P27170 |
NCBI Taxonomy : |
9986 |
Protein names : |
Serum paraoxonase/arylesterase 1 |
Organism : |
Oryctolagus cuniculus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Secreted; |
Length : |
359 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005576 | Cellular Component | extracellular region | NAS | GO:0034364 | Cellular Component | high-density lipoprotein particle | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IDA | GO:0004063 | Molecullar Function | aryldialkylphosphatase activity | ISS | GO:0004064 | Molecullar Function | arylesterase activity | IDA | GO:0005509 | Molecullar Function | calcium ion binding | ISS | GO:0046683 | Biological Process | response to organophosphorus | IDA | |
Catalytic activity : | A phenyl acetate + H2O = a phenol + acetate.An aryl dialkyl phosphate + H2O = dialkyl phosphate + an aryl alcohol.An N-acyl-L-homoserine lactone + H2O = an N-acyl-L-homoserine. |
SWISS-MODEL Repository : | P27170 |
Sequences : |
MAKLTALTLLGLGLALFDGQKSSFQTRFNVHREVTPVELPNCNLVKGIDNGSEDLEILPNGLAFISAGLKYPGIMSFDPDKPGKILLMDLNEKDPVVLELSITGSTFDLSSFNPHGISTFTDEDNIVYLMVVNHPDSKSTVELFKFQEKEKSLLHLKTIRHKLLPSVNDIVAVGPEHFYATNDHYFIDPYLKSWEMHLGLAWSFVTYYSPNDVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPVTGDLWVGCHPNGMRIFYYDPKNPPASEVLRIQDILSKEPKVTVAYAENGTVLQGSTVAAVYKGKMLVGTVFHKALYCELSQAN |
Function : | Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification. |