P25788
UniProt ID : P25788
NCBI Taxonomy : 9606
Protein names : Proteasome subunit alpha type-3
Organism : Homo sapiens
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Nucleus;
Length : 255
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolTAS
GO:0005654Cellular ComponentnucleoplasmTAS
GO:0005839Cellular Componentproteasome core complexIDA
GO:0019773Cellular Componentproteasome core complex, alpha-subunit complexIEA
GO:0004298Molecullar Functionthreonine-type endopeptidase activityIEA
GO:0031145Biological Processanaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processTAS
GO:0002479Biological Processantigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentTAS
GO:0006915Biological Processapoptotic processTAS
GO:0006977Biological ProcessDNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrestTAS
GO:0000082Biological ProcessG1/S transition of mitotic cell cycleTAS
GO:0010467Biological Processgene expressionTAS
GO:0019048Biological Processmodulation by virus of host morphology or physiologyIEA
GO:0016071Biological ProcessmRNA metabolic processTAS
GO:0043066Biological Processnegative regulation of apoptotic processTAS
GO:0051436Biological Processnegative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleTAS
GO:0051437Biological Processpositive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleTAS
GO:0000209Biological Processprotein polyubiquitinationTAS
GO:0006521Biological Processregulation of cellular amino acid metabolic processTAS
GO:0044281Biological Processsmall molecule metabolic processTAS
GO:0016032Biological Processviral processTAS
Catalytic activity :Cleavage of peptide bonds with very broad specificity.
SWISS-MODEL Repository :P25788
Sequences : MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
Function :The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.