show

P25713

UniProt ID :

P25713

NCBI Taxonomy :

9606

Protein names :

Metallothionein-3

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Length :

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0016234	Cellular Component	inclusion body	IDA
GO:0048471	Cellular Component	perinuclear region of cytoplasm	IDA
GO:0008021	Cellular Component	synaptic vesicle	ISS
GO:0016209	Molecullar Function	antioxidant activity	NAS
GO:0046870	Molecullar Function	cadmium ion binding	IDA
GO:0005507	Molecullar Function	copper ion binding	IDA
GO:0043027	Molecullar Function	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA
GO:0008144	Molecullar Function	drug binding	IDA
GO:0030295	Molecullar Function	protein kinase activator activity	IDA
GO:0008270	Molecullar Function	zinc ion binding	IDA
GO:0032148	Biological Process	activation of protein kinase B activity	IDA
GO:0014002	Biological Process	astrocyte development	ISS
GO:0055073	Biological Process	cadmium ion homeostasis	IDA
GO:0008283	Biological Process	cell proliferation	TAS
GO:0044242	Biological Process	cellular lipid catabolic process	ISS
GO:0071276	Biological Process	cellular response to cadmium ion	IDA
GO:0035690	Biological Process	cellular response to drug	IDA
GO:0071456	Biological Process	cellular response to hypoxia	IEP
GO:0071732	Biological Process	cellular response to nitric oxide	IDA
GO:0006882	Biological Process	cellular zinc ion homeostasis	ISS
GO:0006707	Biological Process	cholesterol catabolic process	ISS
GO:0006112	Biological Process	energy reserve metabolic process	ISS
GO:0070371	Biological Process	ERK1 and ERK2 cascade	IDA
GO:0016570	Biological Process	histone modification	IMP
GO:0033210	Biological Process	leptin-mediated signaling pathway	ISS
GO:0010507	Biological Process	negative regulation of autophagy	ISS
GO:0030517	Biological Process	negative regulation of axon extension	IDA
GO:0060547	Biological Process	negative regulation of necrotic cell death	IDA
GO:0043524	Biological Process	negative regulation of neuron apoptotic process	ISS
GO:0051354	Biological Process	negative regulation of oxidoreductase activity	IDA
GO:2000378	Biological Process	negative regulation of reactive oxygen species metabolic process	IDA
GO:0045892	Biological Process	negative regulation of transcription, DNA-dependent	ISS
GO:0070374	Biological Process	positive regulation of ERK1 and ERK2 cascade	IDA
GO:0097214	Biological Process	positive regulation of lysosomal membrane permeability	ISS
GO:0010940	Biological Process	positive regulation of necrotic cell death	IDA
GO:2000376	Biological Process	positive regulation of oxygen metabolic process	ISS
GO:0036091	Biological Process	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IDA
GO:0030949	Biological Process	positive regulation of vascular endothelial growth factor receptor signaling pathway	IDA
GO:0000060	Biological Process	protein import into nucleus, translocation	IDA
GO:0043491	Biological Process	protein kinase B signaling cascade	IDA
GO:0050821	Biological Process	protein stabilization	IDA
GO:0060049	Biological Process	regulation of protein glycosylation	ISS
GO:0032095	Biological Process	regulation of response to food	ISS
GO:0019430	Biological Process	removal of superoxide radicals	IDA
GO:0006829	Biological Process	zinc ion transport	ISS

SWISS-MODEL Repository :

P25713

Sequences :

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Function :

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.