show

P25325

UniProt ID :

P25325

NCBI Taxonomy :

9606

Protein names :

3-mercaptopyruvate sulfurtransferase

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Mitochondrion;Cell junction;

Length :

297

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0030054	Cellular Component	cell junction	IEA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0043005	Cellular Component	neuron projection	ISS
GO:0045202	Cellular Component	synapse	IEA
GO:0016784	Molecullar Function	3-mercaptopyruvate sulfurtransferase activity	IEA
GO:0004792	Molecullar Function	thiosulfate sulfurtransferase activity	TAS
GO:0009440	Biological Process	cyanate catabolic process	TAS
GO:0070814	Biological Process	hydrogen sulfide biosynthetic process	ISS
GO:0009636	Biological Process	response to toxic substance	TAS

Catalytic activity :

3-mercaptopyruvate + cyanide = pyruvate + thiocyanate.Was originally (PubMed:1953758) thought to be rhodanese.

SWISS-MODEL Repository :

P25325

Sequences :

MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

Function :

Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), contributes to the catabolism of cysteine and is an important producer of hydrogen sulfide in the brain, retina and vascular endothelial cells. Hydrogen sulfide H(2)S is an important synaptic modulator, signaling molecule, smooth muscle contractor and neuroprotectant. Its production by the 3MST/CAT pathway is regulated by calcium ions (By similarity).