| P25236 |
| UniProt ID : |
P25236 |
| NCBI Taxonomy : |
10116 |
| Protein names : |
Selenoprotein P |
| Organism : |
Rattus norvegicus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
385 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | IEA | | GO:0008430 | Molecullar Function | selenium binding | IEA | | GO:0010269 | Biological Process | response to selenium ion | IEP | |
| Sequences : |
MWRSLGLALALCLLPYGGAESQGQSPACKQAPPWNIGDQNPMLNSEGTVTVVALLQASUYLCLLQASRLEDLRIKLENQGYFNISYIVVNHQGSPSQLKHAHLKKQVSDHIAVYRQDEHQTDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFPYVEEAIKIAYCEKRCGNCSFTSLEDEAFCKNVSSATASKTTEPSEEHNHHKHHDKHGHEHLGSSKPSENQQPGALDVETSLPPSGLHHHHHHHKHKGQHRQGHLESUDMGASEGLQLSLAQRKLURRGCINQLLCKLSEESGAATSSCCCHCRHLIFEKSGSAITUQCAENLPSLCSUQGLFAEEKVIESCQCRSPPAAUHSQHVSPTEASPNUSUNNKTKKUKUNLN |
| Function : | Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. |