P24707 |
UniProt ID : |
P24707 |
NCBI Taxonomy : |
3349 |
Protein names : |
Superoxide dismutase [Cu-Zn], chloroplastic |
Organism : |
Pinus sylvestris |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
141 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009507 | Cellular Component | chloroplast | IEA | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | P24707 |
Sequences : |
QVEGVVTLSQEDNGPTTVKVRLTGLTPGKHGFHLHEFGDTTNGCMSTGSHFNPKKLTHGAPEDDVRHAGDLGNIVAGSDGVAEATIVDNQIPLSGPDSVIGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI |
Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |