show

P24704

UniProt ID :

P24704

NCBI Taxonomy :

3702

Protein names :

Superoxide dismutase [Cu-Zn] 1

Organism :

Arabidopsis thaliana

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Nucleus;

Length :

152

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IDA
GO:0005576	Cellular Component	extracellular region	IBA
GO:0005634	Cellular Component	nucleus	IDA
GO:0005507	Molecullar Function	copper ion binding	IBA
GO:0004784	Molecullar Function	superoxide dismutase activity	TAS
GO:0008270	Molecullar Function	zinc ion binding	IBA
GO:0071280	Biological Process	cellular response to copper ion	IEP
GO:0071484	Biological Process	cellular response to light intensity	IEP
GO:0071457	Biological Process	cellular response to ozone	IEP
GO:0071472	Biological Process	cellular response to salt stress	IEP
GO:0071329	Biological Process	cellular response to sucrose stimulus	IEP
GO:0071493	Biological Process	cellular response to UV-B	IEP
GO:0042742	Biological Process	defense response to bacterium	IEP
GO:0035195	Biological Process	gene silencing by miRNA	IEP
GO:0019430	Biological Process	removal of superoxide radicals	IBA
GO:0010039	Biological Process	response to iron ion	IEP

Catalytic activity :

2 superoxide + 2 H⁺ = O₂ + H₂O₂.

SWISS-MODEL Repository :

P24704

Sequences :

MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSLATGNAGGRVACGIIGLQG

Function :

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.