show

P22803

UniProt ID :

P22803

NCBI Taxonomy :

559292

Protein names :

Thioredoxin-2

Organism :

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Golgi apparatus membrane;Nucleus;

Length :

104

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IDA
GO:0000324	Cellular Component	fungal-type vacuole	IPI
GO:0000139	Cellular Component	Golgi membrane	IEA
GO:0005634	Cellular Component	nucleus	IEA
GO:0015036	Molecullar Function	disulfide oxidoreductase activity	ISS
GO:0009055	Molecullar Function	electron carrier activity	IEA
GO:0015035	Molecullar Function	protein disulfide oxidoreductase activity	IEA
GO:0045454	Biological Process	cell redox homeostasis	TAS
GO:0034599	Biological Process	cellular response to oxidative stress	ISS
GO:0009263	Biological Process	deoxyribonucleotide biosynthetic process	IEA
GO:0006888	Biological Process	ER to Golgi vesicle-mediated transport	IDA
GO:0006662	Biological Process	glycerol ether metabolic process	IEA
GO:0080058	Biological Process	protein deglutathionylation	IDA
GO:0015031	Biological Process	protein transport	IEA
GO:0006890	Biological Process	retrograde vesicle-mediated transport, Golgi to ER	IDA
GO:0000103	Biological Process	sulfate assimilation	IGI
GO:0042144	Biological Process	vacuole fusion, non-autophagic	IDA
GO:0000011	Biological Process	vacuole inheritance	IMP

SWISS-MODEL Repository :

P22803

Sequences :

MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV

Function :

Participates as a hydrogen donor in redox reactions through the reversible oxidation of its active center dithiol to a disulfide, accompanied by the transfer of 2 electrons and 2 protons. It is involved in many cellular processes, including deoxyribonucleotide synthesis, repair of oxidatively damaged proteins, protein folding, sulfur metabolism, and redox homeostasis. Thioredoxin-dependent enzymes include phosphoadenosine-phosphosulfate reductase MET16, alkyl-hydroperoxide reductase DOT5, thioredoxin peroxidases TSA1 and TSA2, alkyl hydroperoxide reductase AHP1, and peroxiredoxin HYR1. Thioredoxin is also involved in protection against reducing stress. As part of the LMA1 complex, it is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi. This activity does not require the redox mechanism. Through its capacity to inactivate the stress response transcription factor YAP1 and its regulator the hydroperoxide stress sensor HYR1, it is involved in feedback regulation of stress response gene expression upon oxidative stress.