P0CW86 |
UniProt ID : |
P0CW86 |
NCBI Taxonomy : |
99287 |
Protein names : |
Superoxide dismutase [Cu-Zn] 1 |
Organism : |
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Taxonomy : |
Bacteria |
Subcellular locations : | Periplasm; |
Length : |
177 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0042597 | Cellular Component | periplasmic space | IEA | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | P0CW86 |
Sequences : |
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNGLTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLVVNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK |
Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |