| P0CV91 |
| UniProt ID : |
P0CV91 |
| NCBI Taxonomy : |
8730 |
| Protein names : |
Peroxiredoxin-4 |
| Organism : |
Crotalus atrox |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
36 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
GLFIIDDKQITMNDLPVGRSVDETLRLVQAFQYTDK |
| Function : | Venom peroxiredoxin enzyme that may play a role as part of a redox pathway leading to the structural/functional diversification of toxins through a disulfide bond engineering mechanism. |