P0CB50 |
UniProt ID : |
P0CB50 |
NCBI Taxonomy : |
9031 |
Protein names : |
Peroxiredoxin-1 |
Organism : |
Gallus gallus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
199 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005739 | Cellular Component | mitochondrion | IEA | GO:0005634 | Cellular Component | nucleus | IEA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IEA | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
Sequences : |
MSSGKAFIGKPAPDFTATAVMPDGQFKDIKLSDYRGKYVVFFFYPLDFTFVCPTEIIAYSDRADEFKKINCEIIGASVDSHFCHLAWINTPKKQGGLGTMKIPLVSDTKRVIAKDYGVLKEDEGIAYRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Function : | Involved in redox regulation of the cell (By similarity). Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin (By similarity). May play an important role in eliminating peroxides generated during metabolism (By similarity). Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. |