P0C5D4 |
UniProt ID : |
P0C5D4 |
NCBI Taxonomy : |
39946 |
Protein names : |
Putative peroxiredoxin Q, chloroplastic |
Organism : |
Oryza sativa subsp. indica |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
217 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009941 | Cellular Component | chloroplast envelope | IEA | GO:0009533 | Cellular Component | chloroplast stromal thylakoid | IEA | GO:0009535 | Cellular Component | chloroplast thylakoid membrane | IEA | GO:0010287 | Cellular Component | plastoglobule | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0016117 | Biological Process | carotenoid biosynthetic process | IEA | GO:0015995 | Biological Process | chlorophyll biosynthetic process | IEA | GO:0019344 | Biological Process | cysteine biosynthetic process | IEA | GO:0019761 | Biological Process | glucosinolate biosynthetic process | IEA | GO:0006364 | Biological Process | rRNA processing | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
Sequences : |
MAFAVSTACRPSLLLPPRQRSSPPRPRPLLCTPSTAAFRRGALSATTTPTPARAALPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQSL |
Function : | Reduces hydrogen peroxide with reducing equivalents provided through the thioredoxin system (By similarity). |