P0C5C8 |
UniProt ID : |
P0C5C8 |
NCBI Taxonomy : |
39946 |
Protein names : |
1-Cys peroxiredoxin A |
Organism : |
Oryza sativa subsp. indica |
Taxonomy : |
Eukaryota |
Subcellular locations : | Nucleus; |
Length : |
220 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005634 | Cellular Component | nucleus | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0006950 | Biological Process | response to stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P0C5C8 |
Sequences : |
MPGLTIGDTVPNLELDSTHGKIRIHDFVGDTYIILFSHPGDFTPVCTTELAAMAGYAKEFDKRGVKLLGISCDDVQSHKDWIKDIEAYKPGNRVTYPIMADPSREAIKQLNMVDPDEKDSNGGHLPSRALHIVGPDKKVKLSFLYPSCVGRNMDEVVRAVDALQTAAKHAVATPVNWKPGERVVIPPGVSDDEAKEKFPQGFDTADLPSGKGYLRFTKVG |
Function : | Antioxidant protein that seems to contribute to the inhibition of germination during stress (By similarity). |