P0A865 |
UniProt ID : |
P0A865 |
NCBI Taxonomy : |
623 |
Protein names : |
Thiol peroxidase |
Organism : |
Shigella flexneri |
Taxonomy : |
Bacteria |
Subcellular locations : | Periplasm; |
Length : |
168 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0042597 | Cellular Component | periplasmic space | IEA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IEA | |
SWISS-MODEL Repository : | P0A865 |
Sequences : |
MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA |
Function : | Has antioxidant activity. Could remove peroxides or H(2)O(2) within the catalase- and peroxidase-deficient periplasmic space (By similarity). |