| P0A862 |
| UniProt ID : |
P0A862 |
| NCBI Taxonomy : |
83333 |
| Protein names : |
Thiol peroxidase |
| Organism : |
Escherichia coli (strain K12) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Periplasm; |
| Length : |
168 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IDA | | GO:0042597 | Cellular Component | periplasmic space | IEA | | GO:0032843 | Molecullar Function | hydroperoxide reductase activity | IDA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IDA | | GO:0045454 | Biological Process | cell redox homeostasis | IEA | | GO:0034599 | Biological Process | cellular response to oxidative stress | IMP | |
|
| SWISS-MODEL Repository : | P0A862 |
| Sequences : |
MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA |
| Function : | Has antioxidant activity. Could remove peroxides or H(2)O(2) within the catalase- and peroxidase-deficient periplasmic space. |