show

P0A608

UniProt ID :

P0A608

NCBI Taxonomy :

1773

Protein names :

Superoxide dismutase [Cu-Zn]

Organism :

Mycobacterium tuberculosis

Taxonomy :

Bacteria

Subcellular locations :

Cell membrane;

Length :

240

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005618	Cellular Component	cell wall	IDA
GO:0005576	Cellular Component	extracellular region	IDA
GO:0042597	Cellular Component	periplasmic space	IBA
GO:0005886	Cellular Component	plasma membrane	IDA
GO:0005507	Molecullar Function	copper ion binding	IBA
GO:0004784	Molecullar Function	superoxide dismutase activity	IDA
GO:0008270	Molecullar Function	zinc ion binding	IBA
GO:0045454	Biological Process	cell redox homeostasis	IMP
GO:0052060	Biological Process	evasion or tolerance by symbiont of host-produced nitric oxide	IDA
GO:0052059	Biological Process	evasion or tolerance by symbiont of host-produced reactive oxygen species	IDA
GO:0019430	Biological Process	removal of superoxide radicals	IBA
GO:0033194	Biological Process	response to hydroperoxide	IMP

Catalytic activity :

2 superoxide + 2 H⁺ = O₂ + H₂O₂.

SWISS-MODEL Repository :

P0A608

Sequences :

MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG

Function :

Destroys radicals which are normally produced within the cells and which are toxic to biological systems. May play a role in favoring mycobacterial survival in phagocytes (By similarity).