P0A0B7 |
UniProt ID : |
P0A0B7 |
NCBI Taxonomy : |
93061 |
Protein names : |
Alkyl hydroperoxide reductase subunit C |
Organism : |
Staphylococcus aureus (strain NCTC 8325) |
Taxonomy : |
Bacteria |
Length : |
189 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P0A0B7 |
Sequences : |
MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQPGLDLVGKI |
Function : | Directly reduces organic hydroperoxides in its reduced dithiol form. Possesses broad-spectrum activity, being involved in hydrogen peroxide, cumene hydroperoxide, tert-butyl hydroperoxide, paraquat and peroxynitrite resistance. Is important for survival under desiccation conditions. Not required for virulence although is necessary for nasal colonization. |