show

P08226

UniProt ID :

P08226

NCBI Taxonomy :

10090

Protein names :

Apolipoprotein E

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Secreted;

Length :

311

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0042627	Cellular Component	chylomicron	IEA
GO:0005829	Cellular Component	cytosol	TAS
GO:0030425	Cellular Component	dendrite	IEA
GO:0031232	Cellular Component	extrinsic to external side of plasma membrane	IEA
GO:0005794	Cellular Component	Golgi apparatus	IEA
GO:0034364	Cellular Component	high-density lipoprotein particle	IEA
GO:0034363	Cellular Component	intermediate-density lipoprotein particle	IEA
GO:0005770	Cellular Component	late endosome	IEA
GO:0034362	Cellular Component	low-density lipoprotein particle	IDA
GO:0043025	Cellular Component	neuronal cell body	IEA
GO:0034361	Cellular Component	very-low-density lipoprotein particle	IEA
GO:0016209	Molecullar Function	antioxidant activity	IEA
GO:0001540	Molecullar Function	beta-amyloid binding	ISS
GO:0017127	Molecullar Function	cholesterol transporter activity	IDA
GO:0008201	Molecullar Function	heparin binding	IEA
GO:0046848	Molecullar Function	hydroxyapatite binding	IEA
GO:0071813	Molecullar Function	lipoprotein particle binding	IDA
GO:0046911	Molecullar Function	metal chelating activity	IEA
GO:0060228	Molecullar Function	phosphatidylcholine-sterol O-acyltransferase activator activity	IMP
GO:0005543	Molecullar Function	phospholipid binding	IEA
GO:0007568	Biological Process	aging	IEA
GO:0048844	Biological Process	artery morphogenesis	IGI
GO:0006874	Biological Process	cellular calcium ion homeostasis	IDA
GO:0071397	Biological Process	cellular response to cholesterol	IEA
GO:0071363	Biological Process	cellular response to growth factor stimulus	IEA
GO:0071347	Biological Process	cellular response to interleukin-1	IEA
GO:0019934	Biological Process	cGMP-mediated signaling	IEA
GO:0006707	Biological Process	cholesterol catabolic process	IMP
GO:0033344	Biological Process	cholesterol efflux	IDA
GO:0042632	Biological Process	cholesterol homeostasis	IMP
GO:0034382	Biological Process	chylomicron remnant clearance	IEA
GO:0007186	Biological Process	G-protein coupled receptor signaling pathway	IEA
GO:0034380	Biological Process	high-density lipoprotein particle assembly	IEA
GO:0034384	Biological Process	high-density lipoprotein particle clearance	IEA
GO:0034375	Biological Process	high-density lipoprotein particle remodeling	IEA
GO:0042158	Biological Process	lipoprotein biosynthetic process	IGI
GO:0042159	Biological Process	lipoprotein catabolic process	IMP
GO:0034374	Biological Process	low-density lipoprotein particle remodeling	IMP
GO:0051651	Biological Process	maintenance of location in cell	IMP
GO:0043537	Biological Process	negative regulation of blood vessel endothelial cell migration	IEA
GO:0045541	Biological Process	negative regulation of cholesterol biosynthetic process	IEA
GO:0001937	Biological Process	negative regulation of endothelial cell proliferation	IEA
GO:0050728	Biological Process	negative regulation of inflammatory response	IGI
GO:0043407	Biological Process	negative regulation of MAP kinase activity	IEA
GO:0043524	Biological Process	negative regulation of neuron apoptotic process	IEA
GO:0010544	Biological Process	negative regulation of platelet activation	IEA
GO:0007263	Biological Process	nitric oxide mediated signal transduction	IEA
GO:0048709	Biological Process	oligodendrocyte differentiation	IEA
GO:0033700	Biological Process	phospholipid efflux	IEA
GO:0045773	Biological Process	positive regulation of axon extension	IEA
GO:0030828	Biological Process	positive regulation of cGMP biosynthetic process	IEA
GO:0010875	Biological Process	positive regulation of cholesterol efflux	IEA
GO:0010873	Biological Process	positive regulation of cholesterol esterification	IMP
GO:0032805	Biological Process	positive regulation of low-density lipoprotein particle receptor catabolic process	IEA
GO:0051044	Biological Process	positive regulation of membrane protein ectodomain proteolysis	IEA
GO:0051000	Biological Process	positive regulation of nitric-oxide synthase activity	IEA
GO:0006898	Biological Process	receptor-mediated endocytosis	IEA
GO:0032489	Biological Process	regulation of Cdc42 protein signal transduction	IEA
GO:0010468	Biological Process	regulation of gene expression	IMP
GO:0002021	Biological Process	response to dietary excess	IMP
GO:0045471	Biological Process	response to ethanol	IEA
GO:0032868	Biological Process	response to insulin stimulus	IEA
GO:0006979	Biological Process	response to oxidative stress	IMP
GO:0032526	Biological Process	response to retinoic acid	IEA
GO:0043691	Biological Process	reverse cholesterol transport	IEA
GO:0006641	Biological Process	triglyceride metabolic process	IEA
GO:0042311	Biological Process	vasodilation	IMP
GO:0034447	Biological Process	very-low-density lipoprotein particle clearance	IEA
GO:0034372	Biological Process	very-low-density lipoprotein particle remodeling	IMP

SWISS-MODEL Repository :

P08226

Sequences :

MKALWAVLLVTLLTGCLAEGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Function :

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.