| P07148 |
| UniProt ID : |
P07148 |
| NCBI Taxonomy : |
9606 |
| Protein names : |
Fatty acid-binding protein, liver |
| Organism : |
Homo sapiens |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
127 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0045179 | Cellular Component | apical cortex | IEA | | GO:0005829 | Cellular Component | cytosol | IEA | | GO:0005654 | Cellular Component | nucleoplasm | TAS | | GO:0005782 | Cellular Component | peroxisomal matrix | ISS | | GO:0016209 | Molecullar Function | antioxidant activity | IDA | | GO:0032052 | Molecullar Function | bile acid binding | IEA | | GO:0003682 | Molecullar Function | chromatin binding | IEA | | GO:0008144 | Molecullar Function | drug binding | IEA | | GO:0005504 | Molecullar Function | fatty acid binding | IEA | | GO:0005324 | Molecullar Function | long-chain fatty acid transporter activity | IEA | | GO:0005543 | Molecullar Function | phospholipid binding | IEA | | GO:0044255 | Biological Process | cellular lipid metabolic process | TAS | | GO:0070301 | Biological Process | cellular response to hydrogen peroxide | IDA | | GO:0071456 | Biological Process | cellular response to hypoxia | IDA | | GO:0050892 | Biological Process | intestinal absorption | IEA | | GO:0043066 | Biological Process | negative regulation of apoptotic process | IDA | | GO:0043154 | Biological Process | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process | IDA | | GO:0008284 | Biological Process | positive regulation of cell proliferation | IEA | | GO:0032000 | Biological Process | positive regulation of fatty acid beta-oxidation | IEA | | GO:0051345 | Biological Process | positive regulation of hydrolase activity | IEA | | GO:0044281 | Biological Process | small molecule metabolic process | TAS | |
| SWISS-MODEL Repository : | P07148 |
| Sequences : |
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Function : | Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. |