show

P07148

UniProt ID :

P07148

NCBI Taxonomy :

9606

Protein names :

Fatty acid-binding protein, liver

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;

Length :

127

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0045179	Cellular Component	apical cortex	IEA
GO:0005829	Cellular Component	cytosol	IEA
GO:0005654	Cellular Component	nucleoplasm	TAS
GO:0005782	Cellular Component	peroxisomal matrix	ISS
GO:0016209	Molecullar Function	antioxidant activity	IDA
GO:0032052	Molecullar Function	bile acid binding	IEA
GO:0003682	Molecullar Function	chromatin binding	IEA
GO:0008144	Molecullar Function	drug binding	IEA
GO:0005504	Molecullar Function	fatty acid binding	IEA
GO:0005324	Molecullar Function	long-chain fatty acid transporter activity	IEA
GO:0005543	Molecullar Function	phospholipid binding	IEA
GO:0044255	Biological Process	cellular lipid metabolic process	TAS
GO:0070301	Biological Process	cellular response to hydrogen peroxide	IDA
GO:0071456	Biological Process	cellular response to hypoxia	IDA
GO:0050892	Biological Process	intestinal absorption	IEA
GO:0043066	Biological Process	negative regulation of apoptotic process	IDA
GO:0043154	Biological Process	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA
GO:0008284	Biological Process	positive regulation of cell proliferation	IEA
GO:0032000	Biological Process	positive regulation of fatty acid beta-oxidation	IEA
GO:0051345	Biological Process	positive regulation of hydrolase activity	IEA
GO:0044281	Biological Process	small molecule metabolic process	TAS

SWISS-MODEL Repository :

P07148

Sequences :

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Function :

Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.