show

P02692

UniProt ID :

P02692

NCBI Taxonomy :

10116

Protein names :

Fatty acid-binding protein, liver

Organism :

Rattus norvegicus

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;

Length :

127

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0045179	Cellular Component	apical cortex	IDA
GO:0005829	Cellular Component	cytosol	IDA
GO:0005634	Cellular Component	nucleus	IDA
GO:0005782	Cellular Component	peroxisomal matrix	IDA
GO:0016209	Molecullar Function	antioxidant activity	IEA
GO:0032052	Molecullar Function	bile acid binding	IMP
GO:0003682	Molecullar Function	chromatin binding	IEA
GO:0008144	Molecullar Function	drug binding	IPI
GO:0005504	Molecullar Function	fatty acid binding	IDA
GO:0005324	Molecullar Function	long-chain fatty acid transporter activity	IMP
GO:0051978	Molecullar Function	lysophospholipid transporter activity	IC
GO:0005543	Molecullar Function	phospholipid binding	IMP
GO:0070301	Biological Process	cellular response to hydrogen peroxide	IEA
GO:0071456	Biological Process	cellular response to hypoxia	IEA
GO:0050892	Biological Process	intestinal absorption	IDA
GO:0007067	Biological Process	mitosis	TAS
GO:0043066	Biological Process	negative regulation of apoptotic process	IEA
GO:0043154	Biological Process	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA
GO:0008284	Biological Process	positive regulation of cell proliferation	IEP
GO:0032000	Biological Process	positive regulation of fatty acid beta-oxidation	IDA
GO:0051345	Biological Process	positive regulation of hydrolase activity	IDA

SWISS-MODEL Repository :

P02692

Sequences :

MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI

Function :

Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.