show

P00738

UniProt ID :

P00738

NCBI Taxonomy :

9606

Protein names :

Haptoglobin

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Secreted;

Length :

406

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0071682	Cellular Component	endocytic vesicle lumen	TAS
GO:0005615	Cellular Component	extracellular space	IDA
GO:0031838	Cellular Component	haptoglobin-hemoglobin complex	IDA
GO:0016209	Molecullar Function	antioxidant activity	IEA
GO:0003824	Molecullar Function	catalytic activity	IEA
GO:0030492	Molecullar Function	hemoglobin binding	IDA
GO:0006953	Biological Process	acute-phase response	IEA
GO:0006879	Biological Process	cellular iron ion homeostasis	NAS
GO:0006952	Biological Process	defense response	TAS
GO:0042742	Biological Process	defense response to bacterium	IEA
GO:0008152	Biological Process	metabolic process	IEA
GO:2000296	Biological Process	negative regulation of hydrogen peroxide catabolic process	IDA
GO:0051354	Biological Process	negative regulation of oxidoreductase activity	IDA
GO:0010942	Biological Process	positive regulation of cell death	IDA
GO:0042542	Biological Process	response to hydrogen peroxide	IDA

SWISS-MODEL Repository :

P00738

Sequences :

MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Function :

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.