| P00446 |
| UniProt ID : |
P00446 |
| NCBI Taxonomy : |
553611 |
| Protein names : |
Superoxide dismutase [Cu-Zn] |
| Organism : |
Photobacterium leiognathi |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Periplasm; |
| Length : |
173 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0042597 | Cellular Component | periplasmic space | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | P00446 |
| Sequences : |
MNKAKTLLFTALAFGLSHQALAQDLTVKMTDLQTGKPVGTIELSQNKYGVVFTPELADLTPGMHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHGFPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGHAIMIHAGGDNHSDMPKALGGGGARVACGVIQ |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |