show

P00445

UniProt ID :

P00445

NCBI Taxonomy :

559292

Protein names :

Superoxide dismutase [Cu-Zn]

Organism :

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Mitochondrion intermembrane space;

Length :

154

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IDA
GO:0005758	Cellular Component	mitochondrial intermembrane space	IDA
GO:0005634	Cellular Component	nucleus	IDA
GO:0046872	Molecullar Function	metal ion binding	IEA
GO:0004784	Molecullar Function	superoxide dismutase activity	IDA
GO:0001320	Biological Process	age-dependent response to reactive oxygen species involved in chronological cell aging	IMP
GO:0006878	Biological Process	cellular copper ion homeostasis	IGI
GO:0006882	Biological Process	cellular zinc ion homeostasis	IMP
GO:0031505	Biological Process	fungal-type cell wall organization	IMP
GO:1901856	Biological Process	negative regulation of cellular respiration	IMP
GO:0051091	Biological Process	positive regulation of sequence-specific DNA binding transcription factor activity	IMP
GO:0050821	Biological Process	protein stabilization	IMP
GO:0006801	Biological Process	superoxide metabolic process	IMP

Catalytic activity :

2 superoxide + 2 H⁺ = O₂ + H₂O₂.

SWISS-MODEL Repository :

P00445

Sequences :

MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN

Function :

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.